PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g037080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family LFY
Protein Properties Length: 411aa    MW: 45863.5 Da    PI: 6.5922
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g037080.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY642.84.9e-19613931386
           FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseap............leaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdm 81 
                       mdp+afsaslfkwdpr a+ +pp+rlle  a +++p            +++ +  ++r+l +leelf+ayG+ry+t+akiaelGftv+tL+dm
  Sopen03g037080.1   1 MDPDAFSASLFKWDPRGAM-PPPSRLLEPVAPPQPPpplpppppqplpTSSYSIRSTRELGGLEELFQAYGIRYYTAAKIAELGFTVNTLLDM 92 
                       9**************9877.66777777776666555677775555444444444455566******************************** PP

           FLO_LFY  82 kdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelv 174
                       kdeeldd+m+sls+ifr+dllvGeryGikaa+rae rrleeee +++r ++ls+  +++ldalsqeglseepvq+++e+ ++g +g g++e++
  Sopen03g037080.1  93 KDEELDDMMNSLSQIFRWDLLVGERYGIKAAIRAEWRRLEEEE-ARRRGHILSDGGTNVLDALSQEGLSEEPVQQQHEREAAGSGGGGTWEVA 184
                       *****************************************88.88888999999999****************9777665555666699999 PP

           FLO_LFY 175 aaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvq 267
                       a    +++++++k+ + +++r ++++  ++e+  ee+ee+ ++ g+g + +erqrehPfivtepgevargkknGLDYLf+LyeqCr+fL+qvq
  Sopen03g037080.1 185 AGGGGRMKQRRRKK-AGRERRGEEDD--ETEELGEEDEENMNGGGGGGGISERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQ 274
                       99875554444444.23444444333..33334444445555555666667****************************************** PP

           FLO_LFY 268 kiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfn 360
                       +iakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLde+asnalrrafkergenvGawrqacykplvaiaarqgwdida+fn
  Sopen03g037080.1 275 TIAKERGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGAWRQACYKPLVAIAARQGWDIDAIFN 367
                       ********************************************************************************************* PP

           FLO_LFY 361 ahprLsiWYvPtkLrqLChlerskas 386
                       ahprL+iWYvPtkLrqLCh ers+a+
  Sopen03g037080.1 368 AHPRLAIWYVPTKLRQLCHSERSNAA 393
                       ***********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.1E-2151393IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MDPDAFSASL FKWDPRGAMP PPSRLLEPVA PPQPPPPLPP PPPQPLPTSS YSIRSTRELG  60
GLEELFQAYG IRYYTAAKIA ELGFTVNTLL DMKDEELDDM MNSLSQIFRW DLLVGERYGI  120
KAAIRAEWRR LEEEEARRRG HILSDGGTNV LDALSQEGLS EEPVQQQHER EAAGSGGGGT  180
WEVAAGGGGR MKQRRRKKAG RERRGEEDDE TEELGEEDEE NMNGGGGGGG ISERQREHPF  240
IVTEPGEVAR GKKNGLDYLF HLYEQCRDFL IQVQTIAKER GEKCPTKVTN QVFRYAKKAG  300
ASYINKPKMR HYVHCYALHC LDEDASNALR RAFKERGENV GAWRQACYKP LVAIAARQGW  360
DIDAIFNAHP RLAIWYVPTK LRQLCHSERS NAATAASSSV SGGVADHLPH F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy2_A1e-1102324023173PROTEIN LEAFY
2vy1_A1e-1102324023173PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1979340.0AF197934.1 Lycopersicon esculentum FLORICAULA/LEAFY-like protein (FALSIFLORA) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069882.10.0PREDICTED: protein ALF
SwissprotQ405050.0FL2_TOBAC; Floricaula/leafy homolog 2
TrEMBLA0N0C70.0A0N0C7_SOLTU; LEAFY/FLORICAULA
STRINGSolyc03g118160.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-104floral meristem identity control protein LEAFY (LFY)